Publication date: April 2018
Source:Archives of Oral Biology, Volume 88
Author(s): Eiichi Saitoh, Takuya Sega, Akane Imai, Satoko Isemura, Tetsuo Kato, Akihito Ochiai, Masayuki Taniguchi
ObjectivesThe NCBI gene database and human-transcriptome database for alternative splicing were used to determine the expression of mRNAs for P-B (SMR3B) and variant form of P-B. The translational product from the former mRNA was identified as the protein named P-B, whereas that from the latter has not yet been elucidated. In the present study, we investigated the expression of P-B and its variant form at the protein level.DesignTo identify the variant protein of P-B, (1) cationic proteins with a higher isoelectric point in human pooled whole saliva were purified by a two dimensional liquid chromatography; (2) the peptide fragments generated from the in-solution of all proteins digested with trypsin separated and analyzed by MALDI-TOF-MS; and (3) the presence or absence of P-B in individual saliva was examined by 15% SDS-PAGE.ResultsThe peptide sequences (I37PPPYSCTPNMNNCSR52, C53HHHHKRHHYPCNYCFCYPK72, R59HHYPCNYCFCYPK72 and H60HYPCNYCFCYPK72) present in the variant protein of P-B were identified. The peptide sequence (G6PYPPGPLAPPQPFGPGFVPPPPPPPYGPGR36) in P-B (or the variant) and sequence (I37PPPPPAPYGPGIFPPPPPQP57) in P-B were identified. The sum of the sequences identified indicated a 91.23% sequence identity for P-B and 79.76% for the variant. There were cases in which P-B existed in individual saliva, but there were cases in which it did not exist in individual saliva.ConclusionsThe variant protein is produced by excising a non-canonical intron (CC-AC pair) from the 3′-noncoding sequence of the PBII gene. Both P-B and the variant are subject to proteolysis in the oral cavity.
from #ORL-AlexandrosSfakianakis via ola Kala on Inoreader http://ift.tt/2BY1iCP
Αρχειοθήκη ιστολογίου
-
►
2023
(269)
- ► Φεβρουαρίου (133)
- ► Ιανουαρίου (136)
-
►
2022
(2046)
- ► Δεκεμβρίου (165)
- ► Σεπτεμβρίου (161)
- ► Φεβρουαρίου (165)
-
►
2021
(3028)
- ► Δεκεμβρίου (135)
- ► Σεπτεμβρίου (182)
- ► Φεβρουαρίου (324)
-
►
2020
(1051)
- ► Δεκεμβρίου (292)
- ► Σεπτεμβρίου (60)
- ► Φεβρουαρίου (28)
-
►
2019
(2277)
- ► Δεκεμβρίου (18)
- ► Σεπτεμβρίου (54)
- ► Φεβρουαρίου (89)
-
▼
2018
(26280)
- ► Δεκεμβρίου (189)
-
▼
Φεβρουαρίου
(6130)
-
▼
Φεβ 05
(147)
- Baseline neutrophil to lymphocyte ratio combined w...
- Wide skin markings pattern - melanoma descriptor o...
- Application of in vivo reflectance confocal micros...
- Hyaluronan metabolism enhanced during epidermal di...
- Treatment of intrabony defects with modified perfo...
- Assessing the Feasibility of an Electronic Patient...
- Atrial Fibrillation for the Neurologist: Preventin...
- Cancers, Vol. 10, Pages 44: Integrin Inhibitors in...
- Herpes zoster at the vaccination site in immunized...
- Enhanced Recovery After Surgery (ERAS®) in thoraci...
- Is it appropriate to perform video-assisted thorac...
- Table of contents
- Title page / Editorial Board
- Metastatic melanoma with dedifferentiation and ext...
- Event-related desynchronization of mu and beta osc...
- Long-term study of the efficacy and safety of Onab...
- In Vitro and In Vivo Characterization of a Preclin...
- Does Prophylactic Radiotherapy to avoid Gynecomast...
- Evaluation of the genotoxic effects of formocresol...
- Impact of simulated reduced alveolar bone support,...
- Das Recht am eigenen Bild
- Rhinoplastik
- Endoskopisch ausgeführte Tympanoplastik mit Vorteilen
- Fragen für die Facharztprüfung
- Erhöhtes Schlaganfallrisiko nach Neck Dissection?
- Medikamentöse Therapie des Schilddrüsenknotens
- Tympanoplastik Typ I im frühen Kindesalter erfolgs...
- Aktueller Status der Therapie und Prophylaxe des O...
- Durchführung und Interpretation der FEES (Fiberopt...
- „Das Thema künstliche Intelligenz ist in der Radio...
- Seltener Nasennebenhöhlen Tumor
- Kommentar der Schriftleitung
- Current concepts in cleft care: A multicenter anal...
- Response to: baseline asthma burden, comorbidities...
- Biologics in allergic and immunologic diseases: pr...
- Prognostic factors in head and neck mucoepidermoid...
- Donor site morbidity after vascularized fibula fre...
- Editorial Board/Reviewing Committee
- Changes in maxillofacial morphology and velopharyn...
- Quantitative assessment of the learning curve for ...
- The role of psychological factors in the developme...
- Clinical implications of taste thresholds in patie...
- Three-dimensionally printed personalized guide pla...
- Early removal of sequestrum in patients affected b...
- Comparing the Exposure-Response Relationships of P...
- Editorial Board
- Zinc and silica are active components to efficient...
- Maresin 1 regulates autophagy and inflammation in ...
- Comparative proteomic profiling of human dental pu...
- MicroRNA-186 serves as a tumor suppressor in oral ...
- The PBII gene of the human salivary proline-rich p...
- Third molar agenesis as a potential marker for cra...
- Structure, property, and function of sheepshead (A...
- Differentiation of stem cells from human deciduous...
- An in vitro study on the influence of viscosity an...
- Effects of sub-minimum inhibitory concentrations o...
- Proteomics and immunohistochemistry identify the e...
- EMCrit RACC Podcast 217 – The Ultimate “Ultimate” BVM
- Pancreatic cyst biopsy: Improvement in diagnosis w...
- Cytologic-histologic correlation of programmed dea...
- Welcome New Associate Editor Anthony Kim to the Wo...
- Defining Early Recurrence of Hilar Cholangiocarcin...
- Data Improvement Through Simplification: Implicati...
- A Novel Indocyanine Green Fluorescence-Guided Vide...
- Elderly with Heart Failure Have Higher Risk of Hea...
- Integrated optoelectronic microprobes
- Germline promoter hypermethylation in BRCA1 and BR...
- Aortoiliac Dissection After Blunt Abdominal Trauma
- Cochlear implants and 1.5 T MRI scans: the effect ...
- Cavernous sinus involvement is not a risk factor f...
- "Otolaryngol Head Neck Surg"[jour]; +31 new citations
- Commentary on Burke TF et al. “Safety and Feasibil...
- Acute Limb Ischemia Secondary to Native Artery Occ...
- Interdisciplinary Telemedicine in the Management o...
- Selenite Distribution in Multicomponent System Con...
- Ruthenium Counterstaining for Imaging Mass Cytometry
- Cytoplasmic collagen XIαI as a prognostic biomarke...
- Predicting clinical diagnosis in Huntington's dise...
- Orthostatic Heart Rate Changes in Patients with Au...
- Cutaneous meningeal heterotopia on the thigh
- Melanoma Mimicking Rosai-Dorfman Disease
- Single-institution experience of intensity-modulat...
- Interdisciplinary Telemedicine in the Management o...
- Expert’s comment concerning Grand Rounds Case enti...
- Gut Bacteria Influence Effectiveness of a Type of ...
- Feasibility of 15 O-water PET studies of auditory ...
- Solid pseudopapillary tumor of pancreas: A case re...
- Endoscope-assisted conservative resection and reco...
- Sacrifice and extracranial reconstruction of the c...
- Oral retinoids and depression: reply from the authors
- TFM classification and Staging of oral submucous f...
- A Tuscan general with morbid obesity
- Therapeutic effect of Aloe vera and silver nanopar...
- Evaluation of the association of bruxism, psychoso...
- Corrective outcome and transverse stability after ...
- Pre-operative localization of abnormal parathyroid...
- Sir Jeffrey Hudson, the midget of the Queen Henrie...
- NRG oncology RTOG 9006: a phase III randomized tri...
- Female gonadal functions and ovarian reserve in pa...
- Comment on “The pros and cons of continuous glucos...
-
▼
Φεβ 05
(147)
- ► Ιανουαρίου (7050)
-
►
2017
(33948)
- ► Δεκεμβρίου (6715)
- ► Σεπτεμβρίου (6470)
-
►
2016
(4179)
- ► Σεπτεμβρίου (638)
- ► Φεβρουαρίου (526)
- ► Ιανουαρίου (517)
Εγγραφή σε:
Σχόλια ανάρτησης (Atom)
Δεν υπάρχουν σχόλια:
Δημοσίευση σχολίου